PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010920878.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family MYB
Protein Properties Length: 1673aa    MW: 183117 Da    PI: 6.6508
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010920878.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.82.4e-08761802346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT+eE e++ +  + +G++ +++I+  ++ ++t  +c+++++k
   XP_010920878.1 761 PWTQEEKEIFMEMLATFGKD-FTKISCSLN-HKTIADCIEFYYK 802
                      8*****************99.*********.***********98 PP

2Myb_DNA-binding30.77.4e-109741013445
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding    4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45  
                       WT eE   +++a  ++G++ +++I+r++g +R++ qck ++ 
   XP_010920878.1  974 WTDEEKSVFIRALSMYGKD-FARISRCVG-TRSRGQCKIFFS 1013
                       *****************99.*********.********8775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.19E-13745808IPR009057Homeodomain-like
PROSITE profilePS5129313.405757808IPR017884SANT domain
SMARTSM007179.6E-8758806IPR001005SANT/Myb domain
PfamPF002499.9E-7760802IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-5760805IPR009057Homeodomain-like
PROSITE profilePS5129313.6189691020IPR017884SANT domain
SMARTSM007174.5E-79701018IPR001005SANT/Myb domain
SuperFamilySSF466891.56E-109731021IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-59731014IPR009057Homeodomain-like
PfamPF002496.6E-89741012IPR001005SANT/Myb domain
CDDcd001673.79E-79741012No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1673 aa     Download sequence    Send to blast
MPPEPVPWDR KDFVLKERKH ERGPGSEALS TGSSFSAPRW REPCHGPRDF PRASPRRPPS  60
GHYRQGGSYH QIYPEESGGH GCTPSRSDRF WLEDESFRPS SGRYGGGGGG RSSSGGSRES  120
RGSFRRFPYW DSVDFSRQQH HDPHMTAQRS VAVPIPPASQ PPLKDPNDKT GGDVDDGSGT  180
GHRFDQDHSL GSISWKPLKW SRPGSVSSTK AGRSESEETG LEVLLPPGKE SPIRSPVTSP  240
APSDEGAPRK KPRLGWGQGL AKYEKQKVEG SLDPSGTAAK VAVNDTSPKV VGLAGCPSPA  300
TPGSFTCSSS PAGIEEKPCI KAVNGENDTS YFCDSLEEFS TRLGYMEGNP INALNTLLAD  360
LLQTEDASSG DSTYSAMNKL LLLKSGISKE LEKTACELDL FENELKSMDS DAENDPCRSS  420
FVIPPNSAPE PCIESSDVAS KDSNPSKDHE FSSSACTGNT TLYTNSLNEH NTEIKDGDVD  480
NPQAASSRFN DSAFSSMGIY DHDDEKLAGR FEIFEDRFKI PEVQHFILSD VERPALICDH  540
GDGNCVEAGR SSENGNSEAS LHGKTDCNLI TLIMSTNWDA AKRASQVFHK ALPTDPPQFD  600
IWESVKLLSQ RKNDLRIKEK LAIHKYLLKF KEQVLALKFR ALHHLWKEDL RLLSIRKHRT  660
KSSKRFELSS RASQGGSQKQ RCSFRSRFAL PAGNLTLVPT TEILEFSSKL LSDSQIKLYR  720
NNLNMPALIL DEERKQTKFI THNGLIEDPV FFEKERAMIN PWTQEEKEIF MEMLATFGKD  780
FTKISCSLNH KTIADCIEFY YKNHKSESFK EVKKRLDLKK QRQCMPTSSY LVTSGKKWNR  840
GINAASLDML GVASVVAAYS SGNAKSQQRY AGRSIHGTYN GLKVSCGNYR SLERVSSVEI  900
PGHERETVAA DVLAGMCGAL SSEGMSSCVT SSIDPVEKMN YMAVERPLTP DVVQNLDEDT  960
CSNEGCGDLD SFDWTDEEKS VFIRALSMYG KDFARISRCV GTRSRGQCKI FFSKARKCLG  1020
LDVIHQGISN GGMPLGDANG GRGDTDDACA AEMDSAICST QSCSKMDADV SQSVAKINIE  1080
GCVHAAMAPL QAETDRSSEQ GVVGGIILEG EDGKVDKHVS VLPENKLVSG GHNPQSVITL  1140
KKNADAALRS NESVQLHEAV ECVDAEMKVG GSIVSPVEPV FTACVEVESK SHIDDVVQQK  1200
DNDGKYSVDV LKKEVDVPLL MPETGSRNKQ QMDADLTNGG KIFSASNSKA DVNSLLPGKK  1260
VVDCPRSTFS PDYRHQIPLD LLQCLQKKPQ GISLKQENPH SAPLNSVLPD PSSVCFEGPH  1320
HVASQANLNF EEHENKQHHN PVVRDLYQQY MMRNPSLNQV DKPLQILNGY PLQVINQEVK  1380
READPLIGEK PVLMESHPKK NGVSQSNQFF ISEVRGDHCN HSSLSHPRPG VLFPLSEAQP  1440
EAQLRHCSQN ACSEPEEQMH RTSDVKLFGQ IICHPSSSQK SDSSPHECNS KPSAPRINRS  1500
STWKPSDAVK AGMPFASTSG NSGHVGLEEL PARSYGFCDG NIVQTGFSSL PESAVMLAKY  1560
HGSLAGMSFY SAKDGVPCSN GILAQQSYMQ HLASDGKRLE SFCELQKRNG IEMVSGFQQQ  1620
GRVARLGTNM VGGGILSSGG VSDPVAALKM HYAARAKVLS SEMESWRGDI GGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C5e-16725810994NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D5e-16725810994NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010920878.10.0PREDICTED: uncharacterized protein LOC105044622 isoform X1
RefseqXP_010920879.10.0PREDICTED: uncharacterized protein LOC105044622 isoform X1
TrEMBLM0TXE90.0M0TXE9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P04400_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-127MYB family protein